High purity Davalintide Powder
Product Status:White powder
Purity:98%
- Product Description
Hangzhou Go Top Peptide Biotech Co.,Ltd.: Your Trusted Source for High Purity Davalintide Powder
As a leading manufacturer and supplier, Hangzhou Go Top Peptide Biotech Co.,Ltd. offers premium High purity Davalintide Powder. Our state-of-the-art facilities, expert team, and rigorous quality control ensure top-notch products for your research and development needs.
Product Introduction
Our product is a potent amylin analog designed for metabolic disorder research. This synthetic peptide offers enhanced stability and efficacy compared to native amylin. Our product boasts exceptional quality, making it ideal for pharmaceutical development and advanced biomedical studies.
Key Features
- CAS: 863919-85-1
- Sequence: KCNTATCVLGRLSQELHRLQTYPRTNTGSNTY-NH2 (Disulfide bond: 2-7)
- Molecular formula: C152H248N50O49S2
- Molecular weight: 3624.03
Specifications
| Parameter | Specification |
|---|---|
| Appearance | White to off-white powder |
| Purity | ≥98% (HPLC) |
| Solubility | Soluble in water |
| Storage | -20°C, protected from light |
Uses and Applications
Our High purity Davalintide Powder finds applications in:
- Diabetes research
- Obesity studies
- Metabolic disorder investigations
- Drug development for amylin-related therapies
- Preclinical and clinical trials
Company Introduction
Hangzhou Go Top Peptide Biotech Co.,Ltd. is a pioneer in peptide synthesis and research. With years of experience, we deliver cutting-edge solutions to meet the evolving needs of the pharmaceutical and biotechnology industries.
Our Advantages
- State-of-the-art peptide synthesis technology
- Experienced scientific and technical team
- GMP-certified production facilities
- Comprehensive quality control system
- Fast turnaround times and reliable global delivery
- Cost-effective solutions without compromising quality
Laboratory and Factory
Our modern facilities are equipped with advanced technology to ensure the highest quality production of High purity Davalintide Powder. Our dedicated R&D laboratory and GMP-compliant manufacturing units work in tandem to deliver consistent, top-grade products.
Packaging and Shipping
We understand the importance of proper handling for sensitive materials like Davalintide powder. Our packaging adheres to strict standards, ensuring product stability during transit. We offer various package sizes to suit your needs and provide global shipping with tracking.
Certification
Hangzhou Go Top Peptide Biotech Co.,Ltd. proudly holds ISO 9001:2015 certification, demonstrating our commitment to quality management and customer satisfaction.
FAQ
Q1: What is the minimum order quantity for the product?
A1: We offer flexible ordering options. Please contact our sales team for details on minimum order quantities.
Q2: How do you ensure the purity of your Davalintide powder?
A2: We use advanced HPLC techniques and provide detailed certificates of analysis with each batch.
Q3: Can you provide custom synthesis services for Davalintide analogs?
A3: Yes, our experienced team can work with you to develop custom peptides based on your specifications.
Q4: What is the shelf life of your product?
A4: When stored properly at -20°C and protected from light, our Davalintide powder typically has a shelf life of 2 years.
Contact Us
Ready to elevate your research with our premium High purity Davalintide Powder? Contact our expert team today for personalized support and ordering information. Email us at sales1@gotopbio.com or visit our website to learn more about our extensive peptide offerings.
