Ularitide Acetate
Product Status:White powder
Purity:98%
- Product Description
Ularitide Acetate: Premium Peptide for Cardiovascular Research
Are you searching for high-quality Ularitide Acetate for your pharmaceutical or research needs? Look no further! Hangzhou Go Top Peptide Biotech Co., Ltd. is your trusted manufacturer and supplier of premium product. With our state-of-the-art peptide synthesis technology and rigorous quality control, we deliver top-notch products tailored to your specific requirements. Our team of experienced scientists ensures that every batch of the product meets the highest standards of purity and potency.
Product Introduction
Our product is a synthetic form of urodilatin, a natriuretic peptide that plays a crucial role in regulating cardiovascular function. This powerful compound has gained significant attention in the field of heart failure research due to its potential therapeutic effects. Our high-purity product is ideal for pharmaceutical manufacturers, biotechnology firms, and research institutions exploring novel treatments for acute decompensated heart failure.
Key Details
- CAS: 118812-69-4
- Sequence: TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY(C-C)
- Molecular formula: C145H234N52O44S3
- Molecular weight: 3505.99
Specifications
| Parameter | Specification |
|---|---|
| Appearance | White to off-white powder |
| Purity | ≥98% (HPLC) |
| Water Content | ≤5% |
| Acetate Content | 3-8% |
| Counterion Content | ≤1.0% |
Uses and Applications
Ularitide Acetate has shown promise in various cardiovascular applications:
- Treatment of acute decompensated heart failure
- Regulation of blood pressure and fluid balance
- Potential renoprotective effects in acute kidney injury
- Research into natriuretic peptide-based therapies
Our high-quality product is suitable for preclinical studies, clinical trials, and pharmaceutical formulation development.
Company Introduction
Hangzhou Go Top Peptide Biotech Co., Ltd. is a leading peptide manufacturer with a focus on innovation and quality. Our GMP-certified facilities and ISO 9001:2015 certified quality management system ensure that we deliver products that meet global regulatory standards.
Our Advantages
- Cutting-edge peptide synthesis technology
- Experienced scientific team
- Comprehensive custom solutions
- Rigorous quality control
- Fast turnaround times
- Global delivery capabilities
- Cost-effective without compromising quality
Laboratory and Factory
Our state-of-the-art laboratory and manufacturing facilities are equipped with the latest technology to ensure consistent, high-quality production of Ularitide Acetate and other peptides. We maintain strict environmental controls and follow GMP guidelines throughout our production process.
Packaging and Shipping
We understand the importance of preserving the integrity of theproduct during transport. Our packaging meets industry standards for temperature-sensitive materials, and we offer various shipping options to suit your needs, including cold chain logistics for optimal stability.
Certification
Hangzhou Go Top Peptide Biotech Co., Ltd. holds multiple certifications, including:
- ISO 9001:2015 Quality Management System
- GMP Certification
- Various product-specific certifications
FAQ
- Q: What is the minimum order quantity for the product?
A: We offer flexible order quantities to meet your needs. Please contact our sales team for details. - Q: Can you provide stability data for the product?
A: Yes, we can provide comprehensive stability data upon request. - Q: Do you offer custom synthesis services for modified product?
A: Absolutely! Our team can work with you to develop custom peptide solutions. - Q: What documentation is provided with each order?
A: We provide a Certificate of Analysis (COA) and other relevant documentation with each shipment.
Contact Us
Ready to order Ularitide Acetate or have questions? Our team is here to help!
Email: sales1@gotopbio.com
Trust Hangzhou Go Top Peptide Biotech Co., Ltd. for all your product needs. Contact us today to discuss how we can support your research and development efforts!
